Vulpes vulpes (red fox): 112925504 Help Entry 112925504         CDS       T05911                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism vvp  Vulpes vulpes (red fox) Pathway vvp04022   cGMP-PKG signaling pathway vvp04081   Hormone signaling vvp04270   Vascular smooth muscle contraction vvp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     112925504 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     112925504 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     112925504 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112925504 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112925504 (NPPC) Cytokines and neuropeptides [BR:vvp04052]  Neuropeptides   Unclassified    112925504 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  112925504 NCBI-ProteinID:  XP_025862037 UniProt:  A0A3Q7TL83 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRGAWVRLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcgcagctgctggcctgcgccctgctgctcacgctactctcgctccggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgaactccgcccggggaggagctg gccgagccccaggctgcggggggcggtcagaagaagggcgacaaaactcccgggggcggc ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcggggcgcgtgggtgcgcctcctgcatgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system