Vulpes vulpes (red fox): 112928651 Help Entry 112928651         CDS       T05911                                  Symbol IL12B Name (RefSeq) interleukin-12 subunit beta   KO K05425   interleukin 12B Organism vvp  Vulpes vulpes (red fox) Pathway vvp04060   Cytokine-cytokine receptor interaction vvp04620   Toll-like receptor signaling pathway vvp04622   RIG-I-like receptor signaling pathway vvp04625   C-type lectin receptor signaling pathway vvp04630   JAK-STAT signaling pathway vvp04658   Th1 and Th2 cell differentiation vvp04936   Alcoholic liver disease vvp04940   Type I diabetes mellitus vvp05133   Pertussis vvp05134   Legionellosis vvp05140   Leishmaniasis vvp05142   Chagas disease vvp05143   African trypanosomiasis vvp05145   Toxoplasmosis vvp05146   Amoebiasis vvp05152   Tuberculosis vvp05162   Measles vvp05164   Influenza A vvp05168   Herpes simplex virus 1 infection vvp05171   Coronavirus disease - COVID-19 vvp05200   Pathways in cancer vvp05205   Proteoglycans in cancer vvp05321   Inflammatory bowel disease vvp05330   Allograft rejection vvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112928651 (IL12B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112928651 (IL12B)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112928651 (IL12B)    04622 RIG-I-like receptor signaling pathway     112928651 (IL12B)    04625 C-type lectin receptor signaling pathway     112928651 (IL12B)    04658 Th1 and Th2 cell differentiation     112928651 (IL12B)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112928651 (IL12B)    05205 Proteoglycans in cancer     112928651 (IL12B)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     112928651 (IL12B)    05164 Influenza A     112928651 (IL12B)    05162 Measles     112928651 (IL12B)    05168 Herpes simplex virus 1 infection     112928651 (IL12B)   09171 Infectious disease: bacterial    05133 Pertussis     112928651 (IL12B)    05134 Legionellosis     112928651 (IL12B)    05152 Tuberculosis     112928651 (IL12B)   09174 Infectious disease: parasitic    05146 Amoebiasis     112928651 (IL12B)    05145 Toxoplasmosis     112928651 (IL12B)    05140 Leishmaniasis     112928651 (IL12B)    05142 Chagas disease     112928651 (IL12B)    05143 African trypanosomiasis     112928651 (IL12B)   09163 Immune disease    05321 Inflammatory bowel disease     112928651 (IL12B)    05330 Allograft rejection     112928651 (IL12B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112928651 (IL12B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112928651 (IL12B)    04936 Alcoholic liver disease     112928651 (IL12B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vvp04052]     112928651 (IL12B)    00536 Glycosaminoglycan binding proteins [BR:vvp00536]     112928651 (IL12B) Cytokines and neuropeptides [BR:vvp04052]  Cytokines   Interleukins    112928651 (IL12B) Glycosaminoglycan binding proteins [BR:vvp00536]  Heparan sulfate / Heparin   Cytokines    112928651 (IL12B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12p40_C Ig_3 Ig_5 Ig_4 Ig_2 ig fn3 Ig_RIMBP2 IntS9_C I-set Motif Other DBs NCBI-GeneID:  112928651 NCBI-ProteinID:  XP_025866276 LinkDB All DBs Position Unknown AA seq 329 aa AA seqDB search MHPQQLVISWFSLVLLASPLMAVWELEKDVYVVELDWHPDAPGEMVVLTCHTPEEDDITW TSAQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGKVLSRSLLLIHKKEDGIWSTDILKEQ KESKNKIFLKCEAKNYSGRFTCWWLTAISTDLKFRVKSSRGFSDPQGVTCGAVTLSAERV RVDNRDYKKYTVECQEGSACPSAEESLPIEVVVDAIHKLKYENYTSSFFIRDIIKPDPPT NLQLKPLKNSRHVEVSWEYPDTWSTPHSYFSLTFCIQAQGKNNREKKDRLCVDKTSAKVV CHKDAKIRVQARDRYYSSSWSDWASVSCS NT seq 990 nt NT seq  +upstreamnt  +downstreamnt atgcatcctcagcagttggtcatctcctggttttccctcgttttgctggcgtctcccctc atggctgtatgggaactggagaaagatgtttatgttgtagagttggattggcaccctgat gcccccggagaaatggtggtcctcacctgccatacccctgaagaagatgacatcacttgg acttcagcgcagagcagtgaagtcctaggctctggtaaaactctgaccatccaagtcaaa gaatttggagatgctggccagtatacctgccataaaggaggcaaggttctgagccgctca ctcctgttgattcacaaaaaagaagatggaatttggtccactgatatcttaaaggaacag aaagaatccaaaaataagatctttctgaaatgtgaggcaaagaattattctggacgtttc acatgctggtggctgacggcaatcagtactgatttgaaattcagagtcaaaagtagcaga ggcttctctgacccccaaggggtgacatgtggagcagtgacactttcagcagagagggtc agagtggacaacagggattataagaagtacacagtggagtgtcaggagggcagtgcctgc ccctctgccgaggagagcctacccatcgaggtcgtggtggatgctattcacaagctcaaa tatgaaaactacaccagcagcttcttcatcagagacatcatcaaaccagacccacccaca aacctgcagctgaagccattgaaaaattctcggcacgtggaggtcagctgggaatacccc gacacctggagcaccccacattcctacttctccctgacattttgcatacaggcccagggc aagaacaatagagaaaagaaagatagactctgcgtggacaagacctcagccaaggttgtg tgccacaaggatgccaagatccgcgtgcaagcccgagaccgctactatagttcatcctgg agcgactgggcatctgtgtcctgcagttag

DBGET integrated database retrieval system