Vulpes vulpes (red fox): 112929946 Help Entry 112929946         CDS       T05911                                  Name (RefSeq) histone H2A-Bbd type 1-like   KO K11251   histone H2A Organism vvp  Vulpes vulpes (red fox) Pathway vvp03082   ATP-dependent chromatin remodeling vvp04217   Necroptosis vvp04613   Neutrophil extracellular trap formation vvp05034   Alcoholism vvp05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:vvp00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     112929946  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112929946  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112929946  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     112929946   09165 Substance dependence    05034 Alcoholism     112929946  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vvp03036]     112929946   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvp04147]     112929946 Chromosome and associated proteins [BR:vvp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112929946 Exosome [BR:vvp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112929946 SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Cdc6_lid Clp_N Histone_ABTB DUF7555 Motif Other DBs NCBI-GeneID:  112929946 NCBI-ProteinID:  XP_025867974 UniProt:  A0A3Q7SVZ0 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MSGDRGHGHSRRPRRHGMSRSRRAELQFPVSRVDRLLREGHYAHRLSSSTPVFLAGILEY LTSNILELAGQEARNSHKMRITPEHVQKALGNNQYLSQLFENTYSRGGDGVAQARKW NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctggagacagaggccacgggcattcccgtagaccgaggaggcacggcatgtcccgc tccagaagagccgagctgcagttccccgtcagccgcgtggaccgcctcctgcgcgagggt cactacgcccaccgcttaagctcgtccacacctgtgttcctggccggcatcctagagtac ctgacatccaacatcctggagctcgcgggccaggaggcccgcaacagccacaagatgcgc atcacccctgagcacgtgcagaaggccctgggcaacaaccagtacctgagccaactcttt gagaacacctactcccggggtggggatggggtggcccaggccaggaagtggtga

DBGET integrated database retrieval system