Vulpes vulpes (red fox): 112935347 Help Entry 112935347         CDS       T05911                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism vvp  Vulpes vulpes (red fox) Pathway vvp04024   cAMP signaling pathway vvp04062   Chemokine signaling pathway vvp04064   NF-kappa B signaling pathway vvp04210   Apoptosis vvp04380   Osteoclast differentiation vvp04620   Toll-like receptor signaling pathway vvp04621   NOD-like receptor signaling pathway vvp04622   RIG-I-like receptor signaling pathway vvp04623   Cytosolic DNA-sensing pathway vvp04625   C-type lectin receptor signaling pathway vvp04657   IL-17 signaling pathway vvp04658   Th1 and Th2 cell differentiation vvp04659   Th17 cell differentiation vvp04660   T cell receptor signaling pathway vvp04662   B cell receptor signaling pathway vvp04668   TNF signaling pathway vvp04722   Neurotrophin signaling pathway vvp04920   Adipocytokine signaling pathway vvp04926   Relaxin signaling pathway vvp04931   Insulin resistance vvp04936   Alcoholic liver disease vvp05132   Salmonella infection vvp05134   Legionellosis vvp05135   Yersinia infection vvp05140   Leishmaniasis vvp05142   Chagas disease vvp05145   Toxoplasmosis vvp05160   Hepatitis C vvp05161   Hepatitis B vvp05162   Measles vvp05163   Human cytomegalovirus infection vvp05164   Influenza A vvp05166   Human T-cell leukemia virus 1 infection vvp05167   Kaposi sarcoma-associated herpesvirus infection vvp05168   Herpes simplex virus 1 infection vvp05169   Epstein-Barr virus infection vvp05170   Human immunodeficiency virus 1 infection vvp05171   Coronavirus disease - COVID-19 vvp05200   Pathways in cancer vvp05203   Viral carcinogenesis vvp05208   Chemical carcinogenesis - reactive oxygen species vvp05215   Prostate cancer vvp05220   Chronic myeloid leukemia vvp05222   Small cell lung cancer vvp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer vvp05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:vvp00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     112935347 (NFKBIA)    04668 TNF signaling pathway     112935347 (NFKBIA)    04024 cAMP signaling pathway     112935347 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     112935347 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112935347 (NFKBIA)    04621 NOD-like receptor signaling pathway     112935347 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     112935347 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     112935347 (NFKBIA)    04625 C-type lectin receptor signaling pathway     112935347 (NFKBIA)    04660 T cell receptor signaling pathway     112935347 (NFKBIA)    04658 Th1 and Th2 cell differentiation     112935347 (NFKBIA)    04659 Th17 cell differentiation     112935347 (NFKBIA)    04657 IL-17 signaling pathway     112935347 (NFKBIA)    04662 B cell receptor signaling pathway     112935347 (NFKBIA)    04062 Chemokine signaling pathway     112935347 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     112935347 (NFKBIA)    04926 Relaxin signaling pathway     112935347 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     112935347 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     112935347 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112935347 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     112935347 (NFKBIA)    05203 Viral carcinogenesis     112935347 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112935347 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     112935347 (NFKBIA)    05215 Prostate cancer     112935347 (NFKBIA)    05222 Small cell lung cancer     112935347 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112935347 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     112935347 (NFKBIA)    05161 Hepatitis B     112935347 (NFKBIA)    05160 Hepatitis C     112935347 (NFKBIA)    05171 Coronavirus disease - COVID-19     112935347 (NFKBIA)    05164 Influenza A     112935347 (NFKBIA)    05162 Measles     112935347 (NFKBIA)    05168 Herpes simplex virus 1 infection     112935347 (NFKBIA)    05163 Human cytomegalovirus infection     112935347 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     112935347 (NFKBIA)    05169 Epstein-Barr virus infection     112935347 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     112935347 (NFKBIA)    05135 Yersinia infection     112935347 (NFKBIA)    05134 Legionellosis     112935347 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     112935347 (NFKBIA)    05140 Leishmaniasis     112935347 (NFKBIA)    05142 Chagas disease     112935347 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112935347 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112935347 (NFKBIA)    04931 Insulin resistance     112935347 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:vvp03000]     112935347 (NFKBIA)    04131 Membrane trafficking [BR:vvp04131]     112935347 (NFKBIA) Transcription factors [BR:vvp03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     112935347 (NFKBIA) Membrane trafficking [BR:vvp04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     112935347 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  112935347 NCBI-ProteinID:  XP_025874837 UniProt:  A0A3Q7UNM9 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQQAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQLVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcaagccgagcacgcccaggactgggccatggaggggccccgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagctggtgaaggagctgcgggagatccggctcgagccgcaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggccctgaccatggaagtggtccgccaagtgaagggcgac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagcgtg ggagtcctgactcagacttgcaggacccagcacctctactccatcctccaggccaccaac tacaatggtcacacatgtctacatttagcttctatccatggctatttgggcattgtggag cttctggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaaccgcc ctccatcttgcagtggacctgcagaattctgaccttgtgtcacttttgttgaagtgtggg gctgatgtcaacagagttacctaccagggctactccccgtaccagctcacgtggggtcgc ccaagcacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagtgaggatgaggagagctatgacacagagtcagagttcacagaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcttgacgttatga

DBGET integrated database retrieval system