Vulpes vulpes (red fox): 4355763 Help Entry 4355763           CDS       T05911                                  Symbol ND6 Name (RefSeq) NADH dehydrogenase subunit 6   KO K03884   NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2] Organism vvp  Vulpes vulpes (red fox) Pathway vvp00190   Oxidative phosphorylation vvp01100   Metabolic pathways vvp04714   Thermogenesis vvp04723   Retrograde endocannabinoid signaling vvp05010   Alzheimer disease vvp05012   Parkinson disease vvp05014   Amyotrophic lateral sclerosis vvp05016   Huntington disease vvp05020   Prion disease vvp05022   Pathways of neurodegeneration - multiple diseases vvp05208   Chemical carcinogenesis - reactive oxygen species vvp05415   Diabetic cardiomyopathy Module vvp_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:vvp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4355763 (ND6)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4355763 (ND6)   09159 Environmental adaptation    04714 Thermogenesis     4355763 (ND6)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4355763 (ND6)   09164 Neurodegenerative disease    05010 Alzheimer disease     4355763 (ND6)    05012 Parkinson disease     4355763 (ND6)    05014 Amyotrophic lateral sclerosis     4355763 (ND6)    05016 Huntington disease     4355763 (ND6)    05020 Prion disease     4355763 (ND6)    05022 Pathways of neurodegeneration - multiple diseases     4355763 (ND6)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4355763 (ND6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:vvp03029]     4355763 (ND6) Enzymes [BR:vvp01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4355763 (ND6) Mitochondrial biogenesis [BR:vvp03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4355763 (ND6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q3 DUF7475 Motif Other DBs NCBI-GeneID:  4355763 NCBI-ProteinID:  YP_778940 UniProt:  Q08GU3 LinkDB All DBs Position MT AA seq 175 aa AA seqDB search MMTYIVFILSIVFVMSFVGFVTKPSPIYGGLVLIISGGIGCAIVLNFGGSFLGLMVFLIY LGGMLVVFGYTTAMATEQYPEVWVSNKAVLAAFITGLLSELLTACYILKDDEVEVVLKFN GMGDWVIYDTGDSGFFSEEAMGIAALYSYGTWLVIVTGWSLLTGVLVIMEVTRGN NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgataacatacattgtatttattctaagtattgtttttgtgatgagctttgtgggattt gttacgaagccctctcctatttatggtgggttggtgttgattattagtggtgggattggt tgtgctattgtattgaattttggaggatctttcttggggttaatggtgttcttaatttac ttagggggtatattggtagtttttggttatacaactgctatagctacagagcaataccct gaagtttgggtgtctaataaagctgtattggcggcttttatcactggcctgctgtctgag ttattgaccgcctgctatatcttaaaggatgatgaggtggaggtggtactaaagtttaat ggtatgggagactgggttatttatgatacaggtgattctggattttttagtgaagaggct atgggtattgcagcgttatacagctatggtacttgactggtaattgttactggttggtca ttattaactggtgtgttagttattatggaggttacacgtggtaattaa

DBGET integrated database retrieval system