Vibrio vulnificus CMCP6: VV1_0047 Help Entry VV1_0047          CDS       T00108                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism vvu  Vibrio vulnificus CMCP6 Pathway vvu01100   Metabolic pathways vvu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vvu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VV1_0047    00074 Mycolic acid biosynthesis     VV1_0047   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VV1_0047 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AAO08589 UniProt:  A0A3Q0L180 LinkDB All DBs Position I:54548..54808 Genome browser AA seq 86 aa AA seqDB search MEVLQNEIKQLIIDALNLEDISIDDIDTEAPLFGDGLGLDSIDALELGLAIKKKYNIVID ADDNNTRQHFASVANLANYISSQTGN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggaagtactacaaaatgaaattaaacaactgatcatcgatgcactcaatctagaggac atctcgattgatgatatcgacactgaagcaccactgtttggtgatggcttaggtctcgat tcaatcgatgcattagaacttggtttggctattaagaagaaatacaacattgttattgat gcagatgacaataatactcgtcagcactttgcttctgtggcaaatttggcaaactacatt tcttcacaaaccggaaattaa

DBGET integrated database retrieval system