Vibrio vulnificus CMCP6: VV1_0048 Help Entry VV1_0048          CDS       T00108                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism vvu  Vibrio vulnificus CMCP6 Pathway vvu01100   Metabolic pathways vvu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vvu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VV1_0048    00074 Mycolic acid biosynthesis     VV1_0048   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VV1_0048 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  AAO08590 UniProt:  A0A3Q0L143 LinkDB All DBs Position I:54825..55079 Genome browser AA seq 84 aa AA seqDB search MSEVNQQAVFEQVKAALIELFELEEDDIQPDAHLYQDLDLDSIDAVDLVVHLQKVTGKKI QPEEFKAVRTVQDVVDAVVELVKE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtcagaagttaatcaacaagccgtatttgagcaggttaaagccgctctgattgaacta tttgaactagaagaagacgacatccaaccggatgctcatctttatcaggacctagacctg gatagcattgatgccgttgatctggtcgttcatctgcagaaagtgacaggaaagaaaatc caacccgaagagtttaaagcggtacgcacggttcaagacgtcgttgacgctgtcgttgaa cttgtaaaggaataa

DBGET integrated database retrieval system