Vibrio vulnificus YJ016: VV0607 Help Entry VV0607            CDS       T00150                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism vvy  Vibrio vulnificus YJ016 Brite KEGG Orthology (KO) [BR:vvy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vvy03036]     VV0607 Chromosome and associated proteins [BR:vvy03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     VV0607 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL TarH DivIC TraP Motif Other DBs NCBI-ProteinID:  BAC93371 UniProt:  Q7MNV8 LinkDB All DBs Position I:590888..591205 Genome browser AA seq 105 aa AA seqDB search MRQAKPNLAKEIFFDLLTVGRTPLILLVLIFASAMAVVFATHHTRQAITQKDEALQEREH LDNEWRNLMLEETALAEHSRVQEMAKKELEMKRPDGDKEVVINLK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcgtcaagccaagccaaatctcgccaaagaaattttcttcgacctactgacggtaggt cgaacgcctttgatcttgcttgtcctgatctttgcctcagcgatggcggtggtttttgcc acccaccatacccgtcaagcgatcacccaaaaagatgaagcactgcaagagcgtgagcat ttggataacgagtggcgcaatctgatgttggaagagaccgcactggctgagcacagtcgc gtgcaagagatggcgaaaaaagagctcgaaatgaaacggcctgatggcgacaaagaagtg gtgattaatctgaaatga

DBGET integrated database retrieval system