Wielerella bovis: MIS45_10745 Help Entry MIS45_10745       CDS       T08126                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism wbo  Wielerella bovis Pathway wbo01100   Metabolic pathways wbo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:wbo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MIS45_10745 (acpP)    00074 Mycolic acid biosynthesis     MIS45_10745 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MIS45_10745 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ULJ69200 LinkDB All DBs Position 2201762..2201995 Genome browser AA seq 77 aa AA seqDB search MSIEQQVKSIVAEQLGVAIEEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEDAE KITTVQAAIDYVNQKQA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctattgaacaacaagtaaaaagcatcgttgcagaacaattgggcgttgccattgaa gaagtgaaaaacgaatcttctttccaagatgatttgggtgcagactctttggataccgtt gagttagtaatggctttggaagaagcattcggctgcgaaattccagatgaagatgcagaa aaaatcactacggttcaagccgctattgattatgtaaaccaaaaacaagcgtaa

DBGET integrated database retrieval system