Weissella tructae WS08: WS08_0332 Help Entry WS08_0332         CDS       T03228                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism wce  Weissella tructae WS08 Pathway wce01100   Metabolic pathways wce01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:wce00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WS08_0332    00074 Mycolic acid biosynthesis     WS08_0332   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WS08_0332 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Tc-R-P Motif Other DBs NCBI-ProteinID:  AIG65271 UniProt:  A0ABN4DI26 LinkDB All DBs Position 384317..384553 Genome browser AA seq 78 aa AA seqDB search MSREEVFTKVTGLIADHFELDQANIQGSMDLMADVDADSIDFVELVLEMEDEFDAEISDD DAANLKTVDDIVNYIASK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtcgcgaagaagtatttacaaaagtaactggattgattgctgaccattttgaattg gatcaagcaaatattcaaggatcaatggatttgatggcagatgttgacgccgattcaatt gattttgtggaattagttttggaaatggaagacgaatttgacgctgaaatttctgatgac gatgctgccaacttgaagacagttgatgacattgttaactacattgcaagcaagtaa

DBGET integrated database retrieval system