KEGG   Weissella tructae WS08: WS08_0959
Entry
WS08_0959         CDS       T03228                                 
Name
(GenBank) 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
wce  Weissella tructae WS08
Pathway
wce00130  Ubiquinone and other terpenoid-quinone biosynthesis
wce01100  Metabolic pathways
wce01110  Biosynthesis of secondary metabolites
wce01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:wce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    WS08_0959
Enzymes [BR:wce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     WS08_0959
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Ndr Hydrolase_4 DUF915 Thioesterase Esterase Abhydrolase_2 PGAP1 BAAT_C DUF4034 Esterase_PHB Abhydrolase_3
Other DBs
NCBI-ProteinID: AIG65898
UniProt: A0ABM5QSW2
LinkDB
Position
complement(1046932..1047729)
AA seq 265 aa
MNKVVTINDYPYQVTIEGDGQPTWVFFHGFLGSQHEFSAIKPKGTCVYIDLLGFGMAAPT
VSVERLSVSQQIGDLKQLFDALNLEQVHLVGYSMGARLALSFAMTYPEMIKQLILESGTA
GLPSIDEQVERQQKDEKLAQRLEKNGLPDFVAMWEQLPLFATQSQVTETIQMSVRQQRLN
QVAVNMANSLRAFGTGTMPNYWEDLEQLTMPVTVITGALDTKFTDLGQRLDKAIRQSRQI
IVPEVGHNVHLEAPETYTEILESDW
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaataaagttgtcacaattaacgactatccttatcaagtcacgattgaaggggatggg
cagcctacttgggtctttttccatggttttctagggagccaacacgagttttcagccatt
aagccgaaaggcacgtgtgtctatattgatttgcttggctttggtatggcggcaccaacc
gtaagcgttgaacgcttatctgtttcgcaacagattggtgatttaaaacaattgtttgat
gcattaaatctggaacaagttcatttggttggttattcgatgggggcccgtttagcattg
agctttgcgatgacgtatccagaaatgatcaagcaattgattctagaaagcggtacagct
ggtttgccaagtatcgatgaacaagtagaacgccaacaaaaagatgaaaagctagcgcaa
cgtcttgagaaaaatggcttaccagattttgtcgcgatgtgggagcaactccctttgttt
gcgacgcaaagtcaggtgactgaaacgattcagatgtcggtacggcaacaacggcttaac
caagtcgcagttaatatggcgaattcattacgtgcgtttgggacaggaaccatgccaaat
tactgggaagatttagaacagttaaccatgccagtaacggttattacaggagcgttggac
actaaatttactgacttggggcaacgattagataaagccattcgacagagtcgtcagata
attgtgcctgaggtggggcataatgtgcatctcgaggcgcctgaaacctatacggaaatc
ctagagtctgattggtaa

DBGET integrated database retrieval system