Waddlia chondrophila: wcw_1186 Help Entry wcw_1186          CDS       T01255                                  Symbol acpP Name (GenBank) Acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism wch  Waddlia chondrophila Pathway wch01100   Metabolic pathways wch01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:wch00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     wcw_1186 (acpP)    00074 Mycolic acid biosynthesis     wcw_1186 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     wcw_1186 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 Ribosomal_L50 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ADI38543 UniProt:  D6YWN2 LinkDB All DBs Position complement(1260208..1260441) Genome browser AA seq 77 aa AA seqDB search MATEQEVIDIVVEQLGVDKGDVSLEKSFVEDLNADSLDLTELIMTFEERFGIEISEEEAE KLKTVGDVVNYLEKTKS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggctacagaacaagaagtgatcgatattgttgtcgagcaactaggtgtagataaagga gatgtttctcttgagaagtcttttgtcgaagacctcaatgcggattctctagatcttaca gagttgatcatgacttttgaagagcgctttggtattgagatctccgaagaagaagctgaa aagctaaaaactgttggagatgtcgttaattatttggaaaaaaccaaatcgtaa

DBGET integrated database retrieval system