Weissella ceti WS105: WS105_0330 Help Entry WS105_0330        CDS       T03295                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism wci  Weissella ceti WS105 Pathway wci01100   Metabolic pathways wci01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:wci00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WS105_0330    00074 Mycolic acid biosynthesis     WS105_0330   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WS105_0330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Tc-R-P Motif Other DBs NCBI-ProteinID:  AIM63920 UniProt:  A0A075TY63 LinkDB All DBs Position 384222..384458 Genome browser AA seq 78 aa AA seqDB search MSREEVFTKVTGLIADHFELDQANIQGSMDLMADVDADSIDFVELVLEMEDEFDAEISDD DAANLKTVDDIVNYIASK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtcgcgaagaagtatttacaaaagtaactggattgattgctgaccattttgaattg gatcaagcaaatattcaaggatcaatggatttgatggcagatgttgacgccgattcaatt gattttgtggaattagttttggaaatggaagacgaatttgacgctgaaatttctgatgac gatgctgccaacttgaagacagttgatgacattgttaactacattgcaagcaagtaa

DBGET integrated database retrieval system