Weissella ceti WS105: WS105_0782 Help Entry WS105_0782        CDS       T03295                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism wci  Weissella ceti WS105 Brite KEGG Orthology (KO) [BR:wci00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:wci03032]     WS105_0782    03036 Chromosome and associated proteins [BR:wci03036]     WS105_0782    03400 DNA repair and recombination proteins [BR:wci03400]     WS105_0782 DNA replication proteins [BR:wci03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     WS105_0782 Chromosome and associated proteins [BR:wci03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     WS105_0782 DNA repair and recombination proteins [BR:wci03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       WS105_0782 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 DUF2267 Rpf1_C HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AIM64372 LinkDB All DBs Position complement(832722..833024) Genome browser AA seq 100 aa AA seqDB search MANKQELVNDVATATGLTKKDAASAVDAVFSSIQDSLAKGEKVQLIGFGNFEVRSRAARK GRNPQTKEEIEIPASKVPAFKPGKLLRMPLSNQTAIDCSL NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctaacaagcaagaattggtaaatgatgttgcaactgcaactggtttgactaagaag gacgctgcttcagcagtagacgctgttttctcatctatccaagattcattggctaaggga gaaaaggttcaattgatcggattcggaaacttcgaagtgcgttcacgtgcggctcgtaag ggacgtaacccacaaactaaggaagaaatcgaaatcccagcatcaaaggtacctgcattc aagcctggtaagctcttaaggatgccgttaagtaatcaaaccgctatagactgcagttta tag

DBGET integrated database retrieval system