Wolbachia endosymbiont of Aedes aegypti: L0Z57_01965 Help Entry L0Z57_01965       CDS       T08054                                  Symbol rpmB Name (GenBank) 50S ribosomal protein L28   KO K02902   large subunit ribosomal protein L28 Organism weg  Wolbachia endosymbiont of Aedes aegypti Pathway weg03010   Ribosome Brite KEGG Orthology (KO) [BR:weg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     L0Z57_01965 (rpmB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:weg03011]     L0Z57_01965 (rpmB) Ribosome [BR:weg03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Large subunit     L0Z57_01965 (rpmB)   Bacteria     L0Z57_01965 (rpmB) SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L28 LEDGF ILCR1_N DUF7400 Motif Other DBs NCBI-ProteinID:  UJA57366 LinkDB All DBs Position 373162..373476 Genome browser AA seq 104 aa AA seqDB search MSRVCELTNRKKSFGNKVSHSNRKTKRTFLLNLHKVTLTSDILNKKFRFRVATRTLRTID YKGDLDAFLLNTRTIKLSEKAQKIKRRLKKVLVKQEVELAVSDA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt gtgagtagagtttgtgaattaacaaatagaaaaaaatcttttggtaataaggtatcacat tcgaatcgtaaaacaaagcgtacctttcttttaaatttacataaggttacgttgacaagt gatatattgaataaaaagtttagatttcgtgtggcaacaagaactttgagaactatagat tacaaaggtgatttagatgcttttttgctcaacacaagaacgattaaactaagtgagaaa gcgcagaagataaaaagaaggttgaaaaaagttttagtaaagcaagaggtagagttagca gtttcagatgcatag

DBGET integrated database retrieval system