Wolbachia endosymbiont of Aedes aegypti: L0Z57_04895 Help Entry L0Z57_04895       CDS       T08054                                  Symbol rpmF Name (GenBank) 50S ribosomal protein L32   KO K02911   large subunit ribosomal protein L32 Organism weg  Wolbachia endosymbiont of Aedes aegypti Pathway weg03010   Ribosome Brite KEGG Orthology (KO) [BR:weg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     L0Z57_04895 (rpmF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:weg03011]     L0Z57_04895 (rpmF) Ribosome [BR:weg03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Large subunit     L0Z57_04895 (rpmF)   Bacteria     L0Z57_04895 (rpmF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L32p Motif Other DBs NCBI-ProteinID:  UJA57873 LinkDB All DBs Position complement(945829..946011) Genome browser AA seq 60 aa AA seqDB search MAVPKRKKSKSRRNMHRSHHAIEPKNVVVCSTTGEFMLPHNVAVDGSYKGKRVFIKQQAE NT seq 183 nt NT seq  +upstreamnt  +downstreamnt ttggcagttccaaaaagaaaaaagtcaaagtcaaggcgtaatatgcatcgttctcatcat gctattgagcctaagaatgttgtggtatgttcaacaactggggaattcatgttgcctcat aacgtagcagttgatggcagttacaaaggaaaacgggttttcatcaagcaacaggcagag tga

DBGET integrated database retrieval system