Wolbachia endosymbiont of Aedes aegypti: L0Z57_06010 Help Entry L0Z57_06010       CDS       T08054                                  Symbol rpsU Name (GenBank) 30S ribosomal protein S21   KO K02970   small subunit ribosomal protein S21 Organism weg  Wolbachia endosymbiont of Aedes aegypti Pathway weg03010   Ribosome Brite KEGG Orthology (KO) [BR:weg00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     L0Z57_06010 (rpsU)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:weg03011]     L0Z57_06010 (rpsU) Ribosome [BR:weg03011]  Ribosomal proteins   Mitochondria/ Chloroplast    Small subunit     L0Z57_06010 (rpsU)   Bacteria     L0Z57_06010 (rpsU) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S21 Motif Other DBs NCBI-ProteinID:  UJA58065 LinkDB All DBs Position complement(1158205..1158405) Genome browser AA seq 66 aa AA seqDB search MIEVLVHYGDVDRSLPVLKKTIQKEGRGLKMKKQYHEKKSEKRAKKKAEAKKKRYQQECR RQRYGW NT seq 201 nt NT seq  +upstreamnt  +downstreamnt ttgatagaagtattagtccattatggtgatgtagacagatctcttccagtattgaaaaaa acaattcaaaaggaaggaagagggttgaaaatgaaaaaacaatatcatgaaaaaaaatca gaaaaaagagctaaaaagaaagctgaagctaaaaaaaagaggtaccaacaagagtgcaga aggcaacgttatggttggtag

DBGET integrated database retrieval system