Periweissella cryptocerci: EQG49_09770 Help Entry EQG49_09770       CDS       T06454                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism wei  Periweissella cryptocerci Pathway wei00190   Oxidative phosphorylation wei01100   Metabolic pathways Module wei_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:wei00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     EQG49_09770 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:wei00194]     EQG49_09770 (atpE) Photosynthesis proteins [BR:wei00194]  Photosystem and electron transport system   F-type ATPase [OT]    EQG49_09770 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QBO36728 UniProt:  A0A4P6YVC2 LinkDB All DBs Position 2242346..2242585 Genome browser AA seq 79 aa AA seqDB search MDITGLGHLAQIGAGIAAGGAAIGAGIGNGHVIAAMLEGTARQPELEGKLRGTMFLGIGL VEALPILGIVIAFLLINAK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggatatcacaggattaggtcacttggcacaaattggtgctggtattgctgctggtggt gccgctattggtgccggtattggtaatggtcacgttattgcagctatgcttgaaggtact gcacgtcaaccagaactcgaaggtaagttacgtgggactatgttcctcggaattggtctt gttgaagcccttcctatcttagggattgttatcgcgttcctcttgatcaacgctaagtaa

DBGET integrated database retrieval system