Wansuia hejianensis: H9Q79_02345 Help Entry H9Q79_02345       CDS       T08122                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism whj  Wansuia hejianensis Pathway whj01100   Metabolic pathways whj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:whj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9Q79_02345 (acpP)    00074 Mycolic acid biosynthesis     H9Q79_02345 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9Q79_02345 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  QNM09154 UniProt:  A0A7G9GEC2 LinkDB All DBs Position 496805..497038 Genome browser AA seq 77 aa AA seqDB search MLEKMRQILAEQFNCEEDTITEETNFKDDLGADSLDLFELVMALEEEYSIEIPADDLTNL TTVGSVIDYLKDKGVEA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgttagagaaaatgaggcagatccttgctgagcagtttaactgtgaggaggatactatt acggaagaaactaattttaaggatgatctgggtgccgattcactggatttgtttgaactg gtcatggcccttgaggaagagtattccattgagataccggctgatgacctgacgaacctg acaacagttggttccgtaatagattatttaaaggacaaaggtgtggaggcttaa

DBGET integrated database retrieval system