Wansuia hejianensis: H9Q79_03365 Help Entry H9Q79_03365       CDS       T08122                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism whj  Wansuia hejianensis Pathway whj00020   Citrate cycle (TCA cycle) whj00720   Other carbon fixation pathways whj01100   Metabolic pathways whj01110   Biosynthesis of secondary metabolites whj01120   Microbial metabolism in diverse environments whj01200   Carbon metabolism whj01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:whj00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     H9Q79_03365   09102 Energy metabolism    00720 Other carbon fixation pathways     H9Q79_03365 Enzymes [BR:whj01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      H9Q79_03365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_9 Fer4_10 Fer4_4 Fer4_21 Fer4_16 LdpA_Fe-S-bd Fer4_13 Fer4_15 Fer4_3 Fer4_17 Fer4_8 Fer4_22 TSCPD Motif Other DBs NCBI-ProteinID:  QNM09341 UniProt:  A0A7G9GEV9 LinkDB All DBs Position 715442..715639 Genome browser AA seq 65 aa AA seqDB search MAVYIDKELCKSCKICMNICPKNVFEITHHVNKKGYNYVEAVREEDCISCGQCETSCPDF VIHVE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggcggtatatattgataaggagctttgcaaaagctgtaaaatctgcatgaatatctgt ccgaagaacgtgtttgagatcactcatcatgtgaataagaaaggatataactatgtggaa gcagtcagagaagaagactgcataagctgcggccagtgtgagacatcctgccctgatttc gttattcacgtggaatga

DBGET integrated database retrieval system