KEGG   Wansuia hejianensis: H9Q79_05555
Entry
H9Q79_05555       CDS       T08122                                 
Name
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
whj  Wansuia hejianensis
Pathway
whj00260  Glycine, serine and threonine metabolism
whj00261  Monobactam biosynthesis
whj00270  Cysteine and methionine metabolism
whj00300  Lysine biosynthesis
whj01100  Metabolic pathways
whj01110  Biosynthesis of secondary metabolites
whj01120  Microbial metabolism in diverse environments
whj01210  2-Oxocarboxylic acid metabolism
whj01230  Biosynthesis of amino acids
Module
whj_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:whj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H9Q79_05555
   00270 Cysteine and methionine metabolism
    H9Q79_05555
   00300 Lysine biosynthesis
    H9Q79_05555
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    H9Q79_05555
Enzymes [BR:whj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     H9Q79_05555
SSDB
Motif
Pfam: AA_kinase ACT_9 ACT ACT_7 Sorb
Other DBs
NCBI-ProteinID: QNM10426
UniProt: A0A7G9GHZ4
LinkDB
Position
complement(1210807..1212126)
AA seq 439 aa
MKKVVKFGGSSLASAEQFQKVGKIIRSDAARRYVVPSAPGKRFGGDTKVTDMLYGCYRLA
EEGKDFRGALENIKARYMEIIEGLSLNLSMDEQFEEIAKNFQNKAGENYAASRGEYLNGI
VMAEYLGFEFVDAAEVICFDEDGNFDAEKTDEVMSKRLEGLQQAVIPGFYGAKPDGSVKT
FSRGGSDITGSLVAKAVHADLYENWTDVSGFLVTDPRIVKDPATISTITYREMRELSYMG
ATVLHEDAIFPLRREGIPINVRNTNRPEDPGTMIVESTCNKPKYTITGIGGKKGFASITI
EKAMMNSEIGFGRKVLQVFEENGLSFEHTPSGIDTFTVYVHQSEFESKEQQVIAGLHRAV
QPDLIELESDLALIAVVGRGMRRTRGTAGRIFSALAHAHVNVKMIDQGSSELNIIIGVEN
RDFETAIQAIYDIFVTAQI
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaaaaaagtggtgaaatttggcggaagttccctcgccagcgcagaacagtttcagaaa
gtgggaaagattatccgcagcgatgcggcaagaagatatgtggtgccttccgcgccgggc
aaacgtttcggcggagacacgaaggtgaccgacatgctgtacggatgctaccgtctggca
gaggaagggaaagatttcagaggggctttggagaatatcaaagcgcgttatatggagatt
attgaaggtttatccttaaatctttccatggatgagcagtttgaagagattgcgaagaac
tttcaaaataaggccggggagaactatgcggcgtcccgcggcgaatatctgaacggcatt
gtcatggcggagtatctgggatttgaattcgtggatgcggcagaggtcatctgttttgac
gaggatggcaattttgacgcggagaagacagatgaggtgatgtcaaagcgtctggagggg
cttcaacaggcggtgatcccgggcttttacggggcgaagccggatggaagcgtgaagact
ttttccaggggtggttccgacattacgggttcgctggtggcgaaagctgtccatgcggat
ctctatgagaattggacagatgtatccggattcctggtgacagatcccagaatcgtaaaa
gatccagcgactatatccacaatcacataccgtgaaatgagagagctttcctatatggga
gcgactgtccttcacgaggatgctattttcccgctgcggcgggaagggattccgatcaat
gtgaggaataccaaccgtccggaggatccgggaacgatgattgtagagagcacctgcaac
aagcccaaatataccatcaccggcattggcggcaagaagggctttgcctctataaccatc
gagaaagccatgatgaattcagagatcgggtttgggagaaaggttctgcaggtatttgag
gagaatgggctttctttcgagcatacgccctccggaatcgatacttttacagtctatgtg
catcagagcgagtttgaatcgaaggagcagcaggtaattgctggcctgcaccgggccgta
cagccggatctgattgagctggaatccgatctggctctgattgcagtggtgggaagagga
atgcgccgcacccgaggtactgccgggagaatcttctcagcgctggcccacgcccatgtg
aacgtcaagatgatcgaccagggttcctcagaactgaatatcattatcggcgtggaaaac
cgtgattttgagacagcgatacaggcaatttacgatatctttgtgactgcacagatataa

DBGET integrated database retrieval system