Wallemia ichthyophaga: J056_003322 Help Entry J056_003322       CDS       T03457                                  Name (RefSeq) Rho-related protein rac1B   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism wic  Wallemia ichthyophaga Pathway wic04145   Phagosome wic04148   Efferocytosis wic04620   Toll-like receptor signaling pathway wic05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:wic00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     J056_003322    04148 Efferocytosis     J056_003322  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     J056_003322  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     J056_003322  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:wic04131]     J056_003322   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:wic04147]     J056_003322    04031 GTP-binding proteins [BR:wic04031]     J056_003322 Membrane trafficking [BR:wic04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     J056_003322  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     J056_003322   Macropinocytosis    Ras GTPases     J056_003322  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     J056_003322 Exosome [BR:wic04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    J056_003322   Exosomal proteins of other body fluids (saliva and urine)    J056_003322   Exosomal proteins of colorectal cancer cells    J056_003322   Exosomal proteins of bladder cancer cells    J056_003322 GTP-binding proteins [BR:wic04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     J056_003322 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  20376274 NCBI-ProteinID:  XP_009266820 UniProt:  R9AL23 LinkDB All DBs Position Unknown AA seq 196 aa AA seqDB search MASKNIKCVVVGDGAVGKTCLLISYTTNQFPSDYVPTVFDNYQATVLLDGKPVLLGLWDT AGQEDYDRLRPLSYPQTDIFLCCFSIHSPASFENVKYKWWPEISHHAPGVPIILVGTKLD LRSDPQAVNALRARRMEPISFSQGVELSKDINAIKYLECSALTQKGLKGVFDEAIRAVLV PQGRKSKRKQRGCVLI NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atggcttccaagaatattaaatgcgtagtcgtcggcgatggtgctgttggaaagacgtgt ctgctgatatcttatacgacgaatcagtttccaagcgattacgtacccaccgtcttcgac aattaccaagccacggtccttctcgacggcaagcctgtcctccttggcctctgggatact gccggtcaggaggattacgacaggctgaggcccctttcatacccccagacggacatattc ctttgctgcttctctatccactctcccgcctcgttcgagaacgtcaagtacaagtggtgg ccggaaatctcccaccacgctccaggtgtccctatcatcctcgtcggcacgaagctcgac ctccgatccgacccgcaagccgtcaatgcccttagagcccgtagaatggagcccatttcc ttttctcaaggcgttgagctttctaaagacatcaacgcaatcaagtacctcgagtgttcc gcactcacccaaaaaggcttgaaaggcgtcttcgatgaggctatccgtgccgttttggtg cctcagggacgcaaatcaaagcggaagcaaagaggttgcgttttgatttga

DBGET integrated database retrieval system