Nanchangia anserum: H8R18_05225 Help Entry H8R18_05225       CDS       T06883                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism wik  Nanchangia anserum Brite KEGG Orthology (KO) [BR:wik00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:wik03032]     H8R18_05225    03036 Chromosome and associated proteins [BR:wik03036]     H8R18_05225    03400 DNA repair and recombination proteins [BR:wik03400]     H8R18_05225 DNA replication proteins [BR:wik03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     H8R18_05225 Chromosome and associated proteins [BR:wik03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     H8R18_05225 DNA repair and recombination proteins [BR:wik03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       H8R18_05225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Urease_beta DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  QOX82617 LinkDB All DBs Position complement(1126715..1126999) Genome browser AA seq 94 aa AA seqDB search MSVNRTELVAQIAERAQLSKVQAEQALAAFQTILIDSLKAGETVKVTGLFSVDRVERAAR TGRNPRTGEELHIPAGYGVKITPGSTLKKAVSNK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgtccgttaaccgcaccgagcttgttgctcagattgccgagcgcgcgcagctgtccaag gtccaggccgaacaagccctggccgcgttccagaccatcctgatcgactcgctcaaggcg ggcgagaccgtcaaggtcaccggcctgttctcggtcgaccgcgtcgagcgcgctgctcgc accggccgtaaccctcgcaccggtgaggaactgcacatccccgcgggctacggcgtcaag atcacgccgggttcgaccctgaagaaggccgtgtcgaacaagtaa

DBGET integrated database retrieval system