Wenzhouxiangella marina: WM2015_1395
Help
Entry
WM2015_1395 CDS
T04011
Name
(GenBank) ABC transporter ATP-binding protein
KO
K16013
ATP-binding cassette, subfamily C, bacterial CydD
Organism
wma
Wenzhouxiangella marina
Pathway
wma02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
wma00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
WM2015_1395
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
wma02000
]
WM2015_1395
Transporters [BR:
wma02000
]
ABC transporters, eukaryotic type
ABCC (CFTR/MRP) subfamily
ABCC-BAC subgroup
WM2015_1395
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_membrane
AAA_21
AAA_25
AAA_29
SMC_N
AAA_16
RsgA_GTPase
AAA_5
nSTAND1
nSTAND3
AAA_22
NACHT
AAA_14
Motif
Other DBs
NCBI-ProteinID:
AKS41767
UniProt:
A0A0K0XVW6
LinkDB
All DBs
Position
complement(1683475..1685196)
Genome browser
AA seq
573 aa
AA seq
DB search
MATGTEPAPASELSSWLAAQAPGWLRPLAWLAALLEAGLLIAQALLIAGIFEGVLVSGEG
FDSQWPALGILLAMLIGRASITGARAALADTASGRTRQRLRRALFEQQADAGPVDSAGEA
AGALAHRIVDRVDHLDAYYSRFLPQRASALLIPLSIALVVASIDWLAALLLAITAPIIPL
FMALIGRGAQSLSEAQAESTARLSGLFYDRLKGLATIRRLGAGPRVIEWLAEHAQEYRAR
TLRVLRLAFLSSAVLEFFAAVAIASLAIYIGLSLLGYVELGPSAQLTLGGGLAILLLAPD
FFLPLRQLAQHWHDRADALAAAAELRAMLDRPRPARPSTSSRTAEPSRAPNDDELELDHV
SFAYPGRPPLLSGLSLKVRAGERVLIRGPSGVGKSTLLMLMAGFLSPREGQVRYRGRDIA
DLDDQARSRWRAWMNQNSVLFDESLRWNLTLGRVGIPDSRLHECLALAGLADLPDALDQG
FETTLGERGCRLSGGQARRLVLARILLEARPLLLLDEPSEHLDPGSETALWKAIDLATRS
QGLTVIAVSHRPAAERWASRVIDLPFDEQGNAS
NT seq
1722 nt
NT seq
+upstream
nt +downstream
nt
gtggctacgggcactgagccggcaccggccagcgagctttcgagctggctggccgctcaa
gcccccggctggcttcggccgctggcctggctcgcggcgctgctcgaagccggtctgctg
atcgctcaggcactcctgatcgccggcatcttcgaaggcgttctggtgagcggcgagggc
ttcgattcgcaatggccggccctgggcatcctgctggcgatgctgatcgggcgggcttcg
atcaccggcgctcgagccgccctggccgacactgcctccggtcggactcggcaacggctc
cgacgggccctgttcgagcaacaggccgatgccggtcccgtcgattccgccggcgaggcc
gctggcgcactggcccaccgcatcgtcgaccgtgtcgatcatctcgacgcctactactca
cgcttcctgccgcagcgcgcctcggcgctgctgatccccttgagcatcgctctcgtggtg
gcgtcgatcgactggctggccgccctgctgctcgccatcaccgcaccgatcatccccctg
ttcatggccctgatcggccgcggcgcccagagtctgagtgaagcccaggcggaaagcacg
gcgcggctgtcgggcctgttctacgatcggctcaaggggctggccaccatccggcgtctg
ggcgccggcccgcgcgtcatcgaatggcttgccgaacacgctcaggagtatcgggcacgc
acgctacgtgtcctgcgactggctttcctgtcatcggccgtgctggagttcttcgcggcc
gtcgccattgccagcctggcgatctacatcgggctgagtctgctcggttacgtcgaactc
ggcccctcggcgcaactcaccctcggaggcggcctggcgatactgttgctcgcacccgat
ttctttcttccacttcgccagctggcccagcactggcacgatcgtgccgatgcgctggcc
gcagcagccgagttgcgcgccatgctggacaggcctcgtccggcacgcccctcgacttca
tcgaggaccgctgaaccctcgagagcgccgaatgatgacgaactcgaactcgaccatgtg
tccttcgcctacccgggacgtccgccgctgctcagtggactttccctgaaggtccgtgcc
ggggaacgggttctgatccgcgggccgagcggtgtcggcaagagcaccctgctgatgctg
atggctggattcctgtcgccaagggaaggccaggtccgctaccgtggccgtgacatcgcg
gacctggacgaccaggcgcggtcacggtggcgtgcatggatgaaccagaacagcgtcctg
ttcgacgaaagcctgcgctggaacctcacgctgggccgcgtggggattccggattcccgc
ctgcacgagtgtctggctctcgctggcctggccgacctgcccgacgcgctggaccagggc
ttcgagaccacgctgggcgaacggggatgccggctctcgggcggccaggccaggcgcctg
gtgctggccagaatcctgctcgaagccaggccgctgttgctcctcgacgagccgagcgaa
cacctcgatcctggcagcgaaacagcgctgtggaaggcgatcgatctcgccactcgcagc
cagggcctcacggtgattgcggtcagtcaccgccccgccgccgagcgctgggccagccgc
gtcatcgacctgcccttcgatgaacaggggaacgcctcatga
DBGET
integrated database retrieval system