Wenzhouxiangella marina: WM2015_2309 Help Entry WM2015_2309       CDS       T04011                                  Name (GenBank) hypothetical protein   KO K03073   preprotein translocase subunit SecE Organism wma  Wenzhouxiangella marina Pathway wma02024   Quorum sensing wma03060   Protein export wma03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:wma00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     WM2015_2309  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     WM2015_2309  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     WM2015_2309  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:wma02044]     WM2015_2309 Secretion system [BR:wma02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    WM2015_2309 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE TcpE HDPD DUF2649 TgpA_N DUF1129 Motif Other DBs NCBI-ProteinID:  AKS42672 UniProt:  A0A0K0XYF6 LinkDB All DBs Position complement(2732746..2733087) Genome browser AA seq 113 aa AA seqDB search MWALGLLVLLAGVVGFFQFSGEVMTLIRVVGLLVAAGIALALVAKTARGRDMFAFLRETD VERRKVVWPTRQETLQTTLMVIVITVIVAILLFLMDTVFGWVVRRLIGASGGS NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgtgggccctgggcctgctggttctgctggccggcgtggtcgggttcttccagttctcg ggcgaagtcatgaccctgatccgggtcgtcggcctgctggtcgcagccggcattgccctg gcgctcgtggcgaagaccgcccgcggtcgtgacatgttcgcgttcctgcgcgagaccgat gtcgagcgccgcaaggtggtctggccgacccgccaggagaccctgcagacgacgctgatg gtgatcgtgatcaccgtgatcgtcgccatcctgctgttcctgatggacacggtcttcggt tgggtggtgcgccgcctgatcggcgcctccggaggcagttga

DBGET integrated database retrieval system