Wenzhouxiangella marina: WM2015_3006 Help Entry WM2015_3006       CDS       T04011                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism wma  Wenzhouxiangella marina Pathway wma01100   Metabolic pathways wma01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:wma00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WM2015_3006    00074 Mycolic acid biosynthesis     WM2015_3006   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WM2015_3006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AKS43359 UniProt:  A0A0K0Y095 LinkDB All DBs Position 3610968..3611237 Genome browser AA seq 89 aa AA seqDB search MSAEQSPAERKLAELIVESLNLEDLAPEEIEPETPLFGGEYGLDSIDALELALAISREYG VQLKADDEKNRQVFANLRALSAHVESLRA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagtgctgagcagtcgcctgccgagcgcaagctggccgagctgatcgtcgaatcgctc aacctcgaagacctggcccccgaagagatcgagccggaaacgcccctgttcggcggcgaa tacggcctcgattcgatcgatgcgctggagctggccctggccatttcccgcgagtacggg gtccagctcaaggccgacgacgagaagaatcgtcaggtctttgccaatctccgcgccctg agcgcgcacgtcgaatccctgcgcgcctga

DBGET integrated database retrieval system