Wenzhouxiangella marina: WM2015_302 Help Entry WM2015_302        CDS       T04011                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism wma  Wenzhouxiangella marina Pathway wma03060   Protein export wma03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:wma00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     WM2015_302  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     WM2015_302  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:wma02044]     WM2015_302 Secretion system [BR:wma02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    WM2015_302 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF5510 Motif Other DBs NCBI-ProteinID:  AKS40688 UniProt:  A0A0K0XSM2 LinkDB All DBs Position 367658..367861 Genome browser AA seq 67 aa AA seqDB search MPISPFQLVIILLIVLLVFGTKKIRSLGSDLGGAIREFRKGVGENADDDQNRSDAGSDSS DQSPKNP NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgcctatcagcccgtttcaactggtcatcattcttctgatcgtcctactggtcttcggc accaagaagattcgcagcctgggcagtgatctgggcggcgcgatccgcgagttccgcaag ggcgtgggcgaaaatgccgacgacgatcagaatcgctccgacgccggatccgattcctcg gaccagtctcccaagaatccctga

DBGET integrated database retrieval system