Woronichinia naegeliana: KA717_15575 Help Entry KA717_15575       CDS       T08482                                  Name (GenBank) RNA-binding protein hfq   KO K03666   host factor-I protein Organism wna  Woronichinia naegeliana Pathway wna02024   Quorum sensing wna03018   RNA degradation Brite KEGG Orthology (KO) [BR:wna00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     KA717_15575  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     KA717_15575  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:wna03019]     KA717_15575    03036 Chromosome and associated proteins [BR:wna03036]     KA717_15575 Messenger RNA biogenesis [BR:wna03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      KA717_15575 Chromosome and associated proteins [BR:wna03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     KA717_15575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq DUF695 Motif Other DBs NCBI-ProteinID:  UXE63842 UniProt:  A0A977L1K1 LinkDB All DBs Position 3054276..3054488 Genome browser AA seq 70 aa AA seqDB search MAEFDTGLPSIRKIQNLIKTQQNVEVKLITNDLLVGKIRWQDVQCLCLIDSSNQSTLIWR QSIVYLQPKS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggctgaatttgatactggcttacctagcattcgaaaaatccaaaatttgatcaaaact caacaaaatgtcgaagttaagttgatcacgaatgatctgttggttggtaagatccgttgg caggatgttcaatgtctatgcttgattgattcgtctaaccaaagcaccttaatttggcga caatccatcgtctatctacaaccaaaatcctaa

DBGET integrated database retrieval system