Woeseia oceani: BA177_06545 Help Entry BA177_06545       CDS       T04427                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism woc  Woeseia oceani Brite KEGG Orthology (KO) [BR:woc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:woc03032]     BA177_06545    03036 Chromosome and associated proteins [BR:woc03036]     BA177_06545    03400 DNA repair and recombination proteins [BR:woc03400]     BA177_06545 DNA replication proteins [BR:woc03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BA177_06545 Chromosome and associated proteins [BR:woc03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BA177_06545 DNA repair and recombination proteins [BR:woc03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BA177_06545 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Glycos_trans_3N HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2530 Motif Other DBs NCBI-ProteinID:  ANO50907 UniProt:  A0A193LEH2 LinkDB All DBs Position 1481406..1481678 Genome browser AA seq 90 aa AA seqDB search MNKGELIEAVASGADLSRSEATKAVDAVLDSVTQTLADGGTVSLVGFGTFAVKSRAARQG RNPRTGETIQIKASKVPGFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaagggagaacttattgaggcggttgccagtggcgcggacttgtcgcgatcagag gctaccaaagcggttgacgcagtgctcgatagcgttacccagacactggcggatggcggt accgtatccctcgtaggatttggaacgttcgccgttaagtcgcgtgcagcacgtcaggga cgtaatccgcgcactggtgaaacgatccagattaaggcgagtaaagttcctggattcaag gctggcaaagccctgaaggatgccgtaaactag

DBGET integrated database retrieval system