Wallemia mellicola: WALSEDRAFT_21147 Help Entry WALSEDRAFT_21147  CDS       T03142                                  Name (RefSeq) hypothetical protein   KO K03126   transcription initiation factor TFIID subunit 12 Organism wse  Wallemia mellicola Pathway wse03022   Basal transcription factors Brite KEGG Orthology (KO) [BR:wse00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     WALSEDRAFT_21147  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:wse03021]     WALSEDRAFT_21147    03036 Chromosome and associated proteins [BR:wse03036]     WALSEDRAFT_21147 Transcription machinery [BR:wse03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIID      WALSEDRAFT_21147    Coactivators     SAGA/TFTC/STAGA complex      WALSEDRAFT_21147 Chromosome and associated proteins [BR:wse03036]  Eukaryotic type   Histone modification proteins    HAT complexes     PCAF complex      WALSEDRAFT_21147     STAGA complex      WALSEDRAFT_21147     TFTC complex      WALSEDRAFT_21147     SAGA complex      WALSEDRAFT_21147     SLIK complex      WALSEDRAFT_21147 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TFIID_20kDa CBFD_NFYB_HMF Histone DUF5827 Motif Other DBs NCBI-GeneID:  18470876 NCBI-ProteinID:  XP_006959876 JGI:  Walse1_21147 UniProt:  I4Y863 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MANAGKIDPKSLLENDSNRLLGKRKIQELVETVDPSETLDPEVEDLMLEIADEFIESVTN FGCMLAKHRRGDTLEVRDLQLHLGRYLPY NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggccaacgcaggcaagatagatccaaagtctctactggaaaatgacagtaatagattg cttggtaaacgtaaaatacaagaactcgtcgaaactgtcgacccttcagagactttagat cctgaagtagaggatcttatgcttgaaatcgcagatgaattcatcgaaagtgtcacgaac tttgggtgtatgctcgcaaagcatcgcagaggtgatactctcgaagtaagagatcttcaa ttgcatttgggtaggtatcttccttattga

DBGET integrated database retrieval system