Wallemia mellicola: WALSEDRAFT_32913 Help Entry WALSEDRAFT_32913  CDS       T03142                                  Name (RefSeq) symbiosis-related protein   KO K08341   GABA(A) receptor-associated protein Organism wse  Wallemia mellicola Pathway wse04136   Autophagy - other wse04138   Autophagy - yeast wse04139   Mitophagy - yeast wse04145   Phagocytosis wse04156   Integrated stress response (ISR) signaling pathway Brite KEGG Orthology (KO) [BR:wse00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     WALSEDRAFT_32913    04138 Autophagy - yeast     WALSEDRAFT_32913    04136 Autophagy - other     WALSEDRAFT_32913    04139 Mitophagy - yeast     WALSEDRAFT_32913   09143 Cell growth and death    04156 Integrated stress response (ISR) signaling pathway     WALSEDRAFT_32913  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:wse04131]     WALSEDRAFT_32913    04121 Ubiquitin system [BR:wse04121]     WALSEDRAFT_32913    03029 Mitochondrial biogenesis [BR:wse03029]     WALSEDRAFT_32913 Membrane trafficking [BR:wse04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     WALSEDRAFT_32913 Ubiquitin system [BR:wse04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    WALSEDRAFT_32913 Mitochondrial biogenesis [BR:wse03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     WALSEDRAFT_32913 SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  18471586 NCBI-ProteinID:  XP_006958885 JGI:  Walse1_32913 UniProt:  I4YB71 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MVRSKFKDEHPFEKRKAEAERIRQKYPDRIPVICEKGDKTDIPTIDKKKYLVPSDLTVGQ FVYVIRKRIKLAPEKAIFIFVNEELPPTAALMSAIYNEHKDEDGFLYVTYSGENTFG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggttagatctaaatttaaggacgagcacccatttgaaaaacgcaaagcagaagcagag aggattagacagaaatatcctgatagaattcctgtaatttgcgagaaaggcgataaaact gatattcctacgatcgacaagaagaagtacttggttccatccgatcttaccgttggacag ttcgtatacgttattagaaagagaataaaattggctccagagaaggccatcttcattttc gtcaacgaggagttaccgccaactgcagcactaatgagcgcaatctacaatgaacacaaa gacgaagatggtttcttatacgttacttactcgggagagaatacttttggttaa

DBGET integrated database retrieval system