Wallemia mellicola: WALSEDRAFT_43371 Help Entry WALSEDRAFT_43371  CDS       T03142                                  Name (RefSeq) protein translocase SEC6   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism wse  Wallemia mellicola Pathway wse03060   Protein export wse04141   Protein processing in endoplasmic reticulum wse04145   Phagosome Brite KEGG Orthology (KO) [BR:wse00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     WALSEDRAFT_43371    04141 Protein processing in endoplasmic reticulum     WALSEDRAFT_43371  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     WALSEDRAFT_43371  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:wse04131]     WALSEDRAFT_43371   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:wse02044]     WALSEDRAFT_43371 Membrane trafficking [BR:wse04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     WALSEDRAFT_43371 Secretion system [BR:wse02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    WALSEDRAFT_43371 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  18472283 NCBI-ProteinID:  XP_006956694 JGI:  Walse1_43371 UniProt:  I4YH65 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MSDKAREFIELPQQFVKEGSQFMKRCTKPNKREYIQICKAVAIGFAIMGFIGYFVKLIHI PINNILVAGQ NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagtgataaagctagagagtttattgaacttccacagcagttcgttaaggagggttca cagtttatgaagagatgtacgaaaccaaacaaacgcgaatatatacaaatatgcaaagct gtagctattggttttgctataatgggcttcattggttactttgtgaaattgattcatatc ccaattaataacatattagttgcaggtcaataa

DBGET integrated database retrieval system