Wallemia mellicola: WALSEDRAFT_48643 Help Entry WALSEDRAFT_48643  CDS       T03142                                  Name (RefSeq) LSM-domain-containing protein   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism wse  Wallemia mellicola Pathway wse03018   RNA degradation wse03040   Spliceosome Brite KEGG Orthology (KO) [BR:wse00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     WALSEDRAFT_48643   09123 Folding, sorting and degradation    03018 RNA degradation     WALSEDRAFT_48643  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:wse03019]     WALSEDRAFT_48643    03041 Spliceosome [BR:wse03041]     WALSEDRAFT_48643 Messenger RNA biogenesis [BR:wse03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      WALSEDRAFT_48643   mRNA degradation factors    5'-3' decay     Lsm complex      WALSEDRAFT_48643 Spliceosome [BR:wse03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     WALSEDRAFT_48643 SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX LSM14 Motif Other DBs NCBI-GeneID:  18472461 NCBI-ProteinID:  XP_006960234 JGI:  Walse1_48643 UniProt:  I4Y6Y4 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MASQILPLELIDKCIGSRIWVIMKNEREFVGTLQGFDDFVNMVLDDVTEYDISPDGTQKK SKLRQTLLNGNNVCMLLPGGEGPESVQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcatctcagatattgcctttagaactcattgataagtgcattggtagcagaatatgg gtaattatgaagaatgagcgtgaattcgttggtactctgcagggatttgatgacttcgtt aatatggtccttgacgatgtaacagaatatgacatatcgcctgatggtacacaaaagaaa tcaaaacttagacaaacgctactcaacggtaataatgtctgtatgttgcttccaggtgga gagggaccagaaagtgtacaataa

DBGET integrated database retrieval system