Wolinella succinogenes: WS0630 Help Entry WS0630            CDS       T00146                                  Symbol ACPP Name (GenBank) ACYL CARRIER PROTEIN (ACP)   KO K02078   acyl carrier protein Organism wsu  Wolinella succinogenes Pathway wsu01100   Metabolic pathways wsu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:wsu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WS0630 (ACPP)    00074 Mycolic acid biosynthesis     WS0630 (ACPP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WS0630 (ACPP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Ribosomal_L50 PRD Motif Other DBs NCBI-ProteinID:  CAE09761 UniProt:  Q7M9W1 LinkDB All DBs Position complement(616153..616383) Genome browser AA seq 76 aa AA seqDB search MAIFDDIKEVVVEQLNVNPEEVKEESKFVEDLGADSLDVVELVMALEEKFNIEIPDEEAE KIATVGDVVRYIETNK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctatttttgatgatattaaagaagtcgtggtcgaacagctcaatgtcaaccccgaa gaggtgaaggaagaatccaagtttgttgaagatttgggggctgactctttggatgtggtt gagcttgtcatggctctcgaagagaagtttaatatcgagattcctgatgaggaagccgaa aaaatcgctaccgtgggcgatgtggttcgatacatcgaaaccaacaagtaa

DBGET integrated database retrieval system