Wolinella succinogenes: WS1591 Help Entry WS1591            CDS       T00146                                  Name (GenBank) hypothetical protein   KO K02395   peptidoglycan hydrolase FlgJ Organism wsu  Wolinella succinogenes Pathway wsu02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:wsu00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     WS1591  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:wsu02035]     WS1591 Bacterial motility proteins [BR:wsu02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     WS1591 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  CAE10630 UniProt:  Q7MR81 LinkDB All DBs Position complement(1508772..1509074) Genome browser AA seq 100 aa AA seqDB search MLSSIDSSSALYGAQKVPTIENAKSDDEKLKEQTDAFEAIMVKVLLDTALKFDNPLYPKE AGHEIYESMYKEQLSQSLSGGFGYSDLLFNYLKEQQNLTR NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgttatcctctatcgattcttcaagcgccctctatggagcacagaaagtccctactatc gaaaatgccaagagcgacgatgagaaattaaaagaacagacggatgcctttgaggcgatc atggtcaaggttttgctcgatacagcgctcaaatttgacaatccactctaccccaaagag gcggggcacgaaatctacgaatcgatgtataaagagcagctcagccaaagtctctctggc ggatttggctatagcgatctactttttaactatctcaaagagcagcaaaaccttacgcga tga

DBGET integrated database retrieval system