Xanthomonas citri pv. citri 306: XAC2338 Help Entry XAC2338           CDS       T00084                                  Name (GenBank) conserved hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism xac  Xanthomonas citri pv. citri 306 Pathway xac00190   Oxidative phosphorylation xac01100   Metabolic pathways xac02020   Two-component system Module xac_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:xac00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     XAC2338  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     XAC2338 Enzymes [BR:xac01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      XAC2338 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB MFS_1 Motif Other DBs NCBI-ProteinID:  AAM37191 UniProt:  A0AAI7ZFU2 LinkDB All DBs Position 2733416..2733526 Genome browser AA seq 36 aa AA seqDB search MWYFAWILGTGLAALAAVLNGMWFEAREPERGEPSQ NT seq 111 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggatactcggcaccggcctggcggcattggccgcggtgctcaac ggcatgtggttcgaagcacgcgagcccgagcgtggcgaaccgtctcagtaa

DBGET integrated database retrieval system