Xanthomonas sp. GW: HEP73_02580 Help Entry HEP73_02580       CDS       T08755                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xag  Xanthomonas sp. GW Pathway xag01100   Metabolic pathways xag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEP73_02580    00074 Mycolic acid biosynthesis     HEP73_02580   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEP73_02580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Motif Other DBs NCBI-ProteinID:  QNH21657 UniProt:  A0A7G7SY37 LinkDB All DBs Position 3050192..3050473 Genome browser AA seq 93 aa AA seqDB search MTPSIETQIHSIVAKHGEIDPAGLTADTKLQDLGVDSLEAIEILFDIEEHFDITFPQRDP NLDDGSLGKLAEAVQQALAAKAAAAALAPAPAH NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaccccgtctatcgagacacagatccacagcatcgtcgccaagcatggcgagatcgat cccgccggcctgaccgcggacaccaaactgcaggacctgggcgtggattcgctcgaggcg atcgaaatcctgttcgacatcgaggagcacttcgacatcaccttcccgcagcgcgatccg aacctggacgacggctcgctgggcaagctggccgaagcggtgcagcaggcgctggccgcc aaggccgcggccgcggcgctggcaccggcaccggcgcactga

DBGET integrated database retrieval system