Xanthomonas sp. GW: HEP73_03247 Help Entry HEP73_03247       CDS       T08755                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xag  Xanthomonas sp. GW Pathway xag01100   Metabolic pathways xag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEP73_03247 (acpP)    00074 Mycolic acid biosynthesis     HEP73_03247 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEP73_03247 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  QNH22314 UniProt:  A0A7G7SZZ4 LinkDB All DBs Position complement(3848583..3848822) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTNSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKSHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgagcaactcggcgtcaaggaa gaagaagtcaccaacagcgcatcgttcgtcgatgacctgggtgccgactcgctcgatacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgaaattccggacgaagaagcc gagaagatcacctcggtgcagcaggccatcgactacgtcaagtcgcacgtcaagagctga

DBGET integrated database retrieval system