Xanthomonas sp. GW: HEP73_03556 Help Entry HEP73_03556       CDS       T08755                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xag  Xanthomonas sp. GW Brite KEGG Orthology (KO) [BR:xag00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xag03036]     HEP73_03556 Chromosome and associated proteins [BR:xag03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HEP73_03556 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC DUF7342 Motif Other DBs NCBI-ProteinID:  QNH22608 LinkDB All DBs Position complement(4169351..4169614) Genome browser AA seq 87 aa AA seqDB search MSRLLLIVLLACTISSAIGVVYMRHRHRQLFVELSRLEHNRDELNIEFGRLQLEQATWAE SNRVDQVARERLGMKFPETGDIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccggctgctgctcatcgtcctgctcgcctgcaccatctcttcggcgatcggggtg gtgtacatgcgccatcgccatcgccagctgttcgtcgagctgtcgcggctggagcacaac cgcgacgagctgaacatcgaattcggccggttgcagctggagcaggcgacctgggccgaa agcaatcgcgtcgaccaggtcgcgcgcgagcggctgggcatgaagtttccggaaaccggc gacatcgtggtggtgcggccatga

DBGET integrated database retrieval system