Xanthomonas sp. GW: HEP73_04218 Help Entry HEP73_04218       CDS       T08755                                  Symbol acpC Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xag  Xanthomonas sp. GW Pathway xag01100   Metabolic pathways xag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEP73_04218 (acpC)    00074 Mycolic acid biosynthesis     HEP73_04218 (acpC)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEP73_04218 (acpC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QNH23265 LinkDB All DBs Position complement(4934153..4934422) Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPGDIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRIFASLRALSAHVEANKTS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgcaaaccgccgccgaacgtgaactggccgagctgctggtcgagagcctgaac ctggaagacgtgcagcccggcgacatcgatccggaggcgccgctgttcaataccgggctg ggactggactcgatcgacgcgctggaactggcgctggcgatcagcaagcgctacggcttc cagctgcgctcggacaacgacgagaaccgccgcatcttcgcctcgctgcgcgcactgtcg gcgcatgtcgaagccaacaagaccagctga

DBGET integrated database retrieval system