Xanthomonas albilineans: XALC_0128 Help Entry XALC_0128         CDS       T01160                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism xal  Xanthomonas albilineans Pathway xal01100   Metabolic pathways xal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XALC_0128    00074 Mycolic acid biosynthesis     XALC_0128   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XALC_0128 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CBA14674 UniProt:  D2U930 LinkDB All DBs Position 166575..166844 Genome browser AA seq 89 aa AA seqDB search MSSQTPAERELAELLVESLNLEDVQPDDIDPEAALFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRNFASLRALSAHVEANKTH NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgcaaacccccgccgaacgtgaactggccgagcttctggtcgagagcctgaac ctggaggacgtgcagcctgacgatatcgatccggaggcggcgctgttcaacaccgggctg gggttggactcgatcgacgccctggagttggcgttggcgatcagcaagcgctacggcttc cagttgcgctcggataacgacgagaaccgccgcaacttcgcatcgctgcgtgcactgtcg gcgcatgtcgaagcgaataagacccactga

DBGET integrated database retrieval system