KEGG   Xanthomonas albilineans: XALC_2316
Entry
XALC_2316         CDS       T01160                                 
Symbol
blaR1
Name
(GenBank) putative blar1 antirepressor protein
  KO
K02172  bla regulator protein blaR1
Organism
xal  Xanthomonas albilineans
Pathway
xal01501  beta-Lactam resistance
Module
xal_M00627  beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:xal00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    XALC_2316 (blaR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:xal01002]
    XALC_2316 (blaR1)
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:xal01504]
    XALC_2316 (blaR1)
Peptidases and inhibitors [BR:xal01002]
 Metallo peptidases
  Family M56
   XALC_2316 (blaR1)
Antimicrobial resistance genes [BR:xal01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    XALC_2316 (blaR1)
SSDB
Motif
Pfam: Peptidase_M56 TonB_C Peptidase_M48 DUF6476
Other DBs
NCBI-ProteinID: CBA16797
UniProt: D2UEK4
LinkDB
Position
complement(2762083..2763555)
AA seq 490 aa
MSIEAIVTSLATTALAGSVAIVAVLALRTPMRRVFGAGIAYALWIAVPLALLATLVPGGW
RPPLPATFAVAMPSVQVGAPHVVADASAAAASLAMGAGAAWLLALWALGMMTMAALLWRQ
QYRYRRSLGRLQPSEPGVSIAQHALHGPLVLGAWRPQVVLPVDFAQRYPPQQAQLVLAHE
RMHIARGDTRCNLLLAALRCVYWFNPLLHWAATRFRVDQELACDAAVLARHPSSRRSYAE
AMLQTQLDAVALPVGCHWRASALLRQRIVLLQRPVVRGWRRGVGIAVVAMAALGGSVAAL
VFPASVPANAMARDVVPSGVVKDTLDQPAPRGASHPGTATAGASARIPTSRFMPPPHYPN
AAIRAGISGKLVLLLKVDAVGKVRAVRVLDHGSGSPALDAAAVAAAWQWRFNPAMAHGRA
VAAMLKVPVAFEVGMDPVSPPAGVADAGRYRWYRLGEEAGKGVADLCDKLTPDTRGRTAL
PLCGMTTAVR
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgagcattgaagcaatcgtgacaagccttgcaacgacggcgttggctggcagtgtggca
atcgtggcggttttggcgttgcgcacaccgatgcggcgcgtcttcggtgctggcattgcc
tatgcgctgtggatcgcggtgccgctggcgttgctcgccacgctggtgccgggcggttgg
cgcccgccgctgccggcgacctttgcggtggcgatgccgagcgtgcaggtaggcgcgccg
catgtcgtggcggatgcgtccgccgccgccgcatcgctggcaatgggagccggcgcggcc
tggctgttggcgctctgggcgttgggcatgatgacgatggccgcgttgctgtggcggcaa
cagtaccgttatcgccgcagcttgggccgtttgcagccgagtgagccgggcgtgtcgatc
gcgcaacatgcgctgcatggtccactggtactgggcgcgtggcggccgcaggtggtgttg
ccggtggacttcgctcagcgctatccgccgcagcaggcacagttggtgctggcgcacgaa
cgcatgcacatcgcccgcggcgatacgcgctgcaatctgttgctggcggcattacgctgc
gtgtactggttcaatccgttgttgcactgggcggcgacccgcttccgcgtcgatcaggag
ctggcctgcgatgccgcggtgcttgcacggcatccatcttcgcgccgcagctacgccgag
gcgatgctgcagacgcagttggatgcggtcgcgttgcctgtcggttgtcattggcgggcg
agcgcactgctgcggcaacgcatcgtgctgctgcagcggcctgtggtgcgtggctggcgg
cggggtgtcggcattgcggtggtcgcgatggccgcactgggcggtagcgtcgcggcgctg
gtgtttcctgccagcgtgccggctaacgccatggcccgcgatgtggttcccagtggcgtg
gtgaaagacacgctggatcagccggcaccgcgcggggcgtcgcatccggggactgcgacg
gcgggcgccagtgcgcggattcccacgtcgcgtttcatgcccccgccgcactatccgaat
gcggccatccgtgctgggatttccggcaagttggtgctgctactcaaggtggacgcggtc
ggtaaagtccgcgctgtgcgcgtgctcgaccacggcagcggcagcccggcgctggatgct
gcggcggtcgccgcagcttggcaatggcgcttcaacccggccatggcgcatggccgggcg
gtcgctgccatgttgaaggttccggtcgctttcgaggtcggcatggatccggtgtcgccg
ccggcgggtgttgccgatgccgggcggtatcgctggtatcgattgggcgaggaggctggc
aagggggtggcagatttgtgcgacaagttgactccagacacgcgcggtcgtacggcgctg
ccgctgtgcggcatgaccacggcggtgcgatga

DBGET integrated database retrieval system