Xanthomonas sp. ISO98C4: AC801_04005 Help Entry AC801_04005       CDS       T06033                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism xan  Xanthomonas sp. ISO98C4 Brite KEGG Orthology (KO) [BR:xan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xan03036]     AC801_04005 Chromosome and associated proteins [BR:xan03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AC801_04005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC CLLAC DUF7342 Motif Other DBs NCBI-ProteinID:  AZU29047 UniProt:  A0A3Q9PYD4 LinkDB All DBs Position 960550..960813 Genome browser AA seq 87 aa AA seqDB search MSRLLLVVLLACSIASAIGVVYMRHMHRKLFVQLSKLEHTRDELNIEFGRLQLEQATWAE SNRVDQVARARIGMKFPETNDIVVVRP NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagccgcttgctgctcgtcgtgctgcttgcctgcagcatcgcctcggcgatcggggtg gtgtacatgcgccacatgcatcgcaagctgttcgtgcagttgtccaagctcgaacacacg cgcgacgaactgaatatcgaattcggccggctgcagctggagcaggccacgtgggcggaa agcaaccgggtcgatcaggtcgcgcgtgcgcgcatcgggatgaagttcccggagaccaac gacatcgtggtggtgcgcccatga

DBGET integrated database retrieval system