Xanthomonas sp. ISO98C4: AC801_08480 Help Entry AC801_08480       CDS       T06033                                  Name (GenBank) heme exporter protein CcmD   KO K02196   heme exporter protein D Organism xan  Xanthomonas sp. ISO98C4 Pathway xan02010   ABC transporters Brite KEGG Orthology (KO) [BR:xan00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     AC801_08480  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:xan02000]     AC801_08480 Transporters [BR:xan02000]  ABC transporters, prokaryotic type   ABC-2 type and other transporters    Heme transporter     AC801_08480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcmD CopD She9_MDM33 Motif Other DBs NCBI-ProteinID:  AZU29894 UniProt:  A0A3Q9Q1M1 LinkDB All DBs Position complement(1969948..1970154) Genome browser AA seq 68 aa AA seqDB search MSTFLAMGGYGQYVWTAYALFVLVLLADLAAPWLRRRRLPRELRGQLQRQAPRRVRDQPA PALERDAP NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagcacctttctggcgatgggcggctacggccagtacgtgtggaccgcctacgcattg ttcgtgctggtactgctggccgatcttgcagcgccctggctgcgccgccgccggctgccg cgcgaactgcgcggccagttgcagcggcaggcaccgcggcgtgtacgcgatcaaccggca ccggcactggagcgcgacgcgccatga

DBGET integrated database retrieval system