Xanthomonas sp. ISO98C4: AC801_17475 Help Entry AC801_17475       CDS       T06033                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xan  Xanthomonas sp. ISO98C4 Pathway xan00290   Valine, leucine and isoleucine biosynthesis xan00650   Butanoate metabolism xan00660   C5-Branched dibasic acid metabolism xan00770   Pantothenate and CoA biosynthesis xan01100   Metabolic pathways xan01110   Biosynthesis of secondary metabolites xan01210   2-Oxocarboxylic acid metabolism xan01230   Biosynthesis of amino acids Module xan_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xan_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xan00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     AC801_17475    00660 C5-Branched dibasic acid metabolism     AC801_17475   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     AC801_17475   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     AC801_17475 Enzymes [BR:xan01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      AC801_17475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  AZU31592 UniProt:  A0A3Q9Q3C3 LinkDB All DBs Position 4100521..4100778 Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLKPAEGALVRVIGMTERRGFRPCAIQGAAAPDDAGRWHLLLDVDSNRPPETL RLQLEKVYDCESVVITALESVEAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgatctggtgctgaagccggcagaaggcgcgttggtgcgggtgatc ggcatgaccgaacgccgcggcttccgcccatgcgcgatccagggcgccgcagcgccagac gatgccgggcgctggcatctgctgctggatgtggacagcaaccgtccgccggaaacgctg cgcctgcagctggaaaaggtctacgactgcgaatcggtggtgatcaccgcactggaatcg gtcgaggcggcggcatga

DBGET integrated database retrieval system