Xanthomonas axonopodis Xac29-1: XAC29_02035 Help Entry XAC29_02035       CDS       T02500                                  Name (GenBank) HrpE protein   KO K18375   type III secretion hrp pilus HrpE Organism xao  Xanthomonas axonopodis Xac29-1 Module xao_M00660   Xanthomonas spp. pathogenicity signature, T3SS and effectors Brite KEGG Orthology (KO) [BR:xao00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:xao02044]     XAC29_02035 Secretion system [BR:xao02044]  Type III secretion system   Type III secretion related proteins    XAC29_02035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AGH75941 LinkDB All DBs Position complement(471824..472105) Genome browser AA seq 93 aa AA seqDB search MELLPQISSIKSRFDQGTDAYTGGVSGGISGEAALTGANGQMSSLISDMNASDEAQKSMN NKITQLKNDLDFNVALNKFIGKAGDNAKQLVGQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaattattaccgcaaatcagttcaatcaaatcgcgttttgaccagggcacggacgcc tacaccgggggtgtgtccggtggaatctctggtgaggctgcactcacgggcgcgaacggg cagatgagttcgttgatcagtgacatgaacgcctcggacgaggcccagaagtccatgaac aacaagatcacgcagcttaaaaatgatctggacttcaacgtggcgctgaacaagttcatc ggcaaggccggcgacaacgccaagcagctcgttggccagtaa

DBGET integrated database retrieval system