Xanthomonas axonopodis Xac29-1: XAC29_02055 Help Entry XAC29_02055       CDS       T02500                                  Name (GenBank) HrcS protein   KO K03227   type III secretion protein S Organism xao  Xanthomonas axonopodis Xac29-1 Pathway xao03070   Bacterial secretion system Module xao_M00660   Xanthomonas spp. pathogenicity signature, T3SS and effectors Brite KEGG Orthology (KO) [BR:xao00001]  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     XAC29_02055  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:xao02044]     XAC29_02055 Secretion system [BR:xao02044]  Type III secretion system   Type III secretion core apparatus    XAC29_02055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_export_3 CDP-OH_P_tran_2 PhaG_MnhG_YufB DUF1002 DUF6611 Motif Other DBs NCBI-ProteinID:  AGH75945 LinkDB All DBs Position complement(474183..474443) Genome browser AA seq 86 aa AA seqDB search MDHDDLVRFTSEALLLCLKVSLPVVGVAALAGLLIAFIQAVMSLQDASISFALKLVVVVA AIAVTAPWGASAIMQFGQALMQAAFP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggaccacgacgatctagtgcgatttacctccgaagcgttgctgctctgcctcaaggtc tccttgccggtggtcggtgtcgctgcgctggccgggctgttgatcgccttcatccaggcg gtgatgtcgctgcaggacgcatcgatttcgttcgcgctcaagctggtggtggtggtggcc gccattgcggtgacggcgccgtggggcgcgtcggcgatcatgcagttcggccaggcattg atgcaggcggcgttcccatga

DBGET integrated database retrieval system