Xanthomonas axonopodis Xac29-1: XAC29_20660 Help Entry XAC29_20660       CDS       T02500                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xao  Xanthomonas axonopodis Xac29-1 Pathway xao01100   Metabolic pathways xao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XAC29_20660    00074 Mycolic acid biosynthesis     XAC29_20660   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XAC29_20660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGH79517 LinkDB All DBs Position complement(4783837..4784106) Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPADIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRIFASLRALSAHVQANKTV NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgcaaaccgctgccgaacgtgaactggccgaactcctggtcgaaagtctgaac ctggaagacgtccagcccgccgacatcgatccggaggcgccgttgttcaataccgggctg gggctggactcgatcgacgcactggaactggcgctggcgatcagcaagcgctacggcttc cagttgcgctcggacaacgacgaaaaccgtcgcatcttcgcgtcgctgcgcgcactgtcg gcgcatgtccaagccaacaagaccgtctga

DBGET integrated database retrieval system