Xanthomonas arboricola: XB05_00340 Help Entry XB05_00340        CDS       T06096                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xar  Xanthomonas arboricola Pathway xar01100   Metabolic pathways xar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XB05_00340    00074 Mycolic acid biosynthesis     XB05_00340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XB05_00340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  AKC77366 LinkDB All DBs Position 58893..59132 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgacctgggtgccgactcgctggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggct gagaagatcacctcggtccagcaggcgatcgactacgtcaaggctcacgtcaagagctga

DBGET integrated database retrieval system