Xanthomonas arboricola: XB05_03730 Help Entry XB05_03730        CDS       T06096                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism xar  Xanthomonas arboricola Pathway xar02024   Quorum sensing xar03018   RNA degradation Brite KEGG Orthology (KO) [BR:xar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     XB05_03730  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     XB05_03730  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xar03019]     XB05_03730    03036 Chromosome and associated proteins [BR:xar03036]     XB05_03730 Messenger RNA biogenesis [BR:xar03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      XB05_03730 Chromosome and associated proteins [BR:xar03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     XB05_03730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AKC81226 LinkDB All DBs Position 880312..880590 Genome browser AA seq 92 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSVYLVNGIKLQGTIESFDQFVVLLRNTVSQMVYKHAIS TVVPARNVRVGPGGGYVQSNEGNQAEDDDVEQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaggacccattcctcaacgcgctgcggcgcgagcgggtg ccggtttctgtgtatctggtcaacggcatcaagctgcagggcacgatcgagtcgttcgac cagttcgtggtcctgctgcgcaataccgtgagtcagatggtctacaagcacgccatctcc acggtcgtgccggcgcgcaatgtgcgcgtgggaccgggtggtgggtatgtgcaatccaat gaaggcaaccaggcggaagatgacgacgtcgagcagtaa

DBGET integrated database retrieval system